Anhänglich

Anhänglich
Anmerkung: Bei der Erstellung dieses Comics wurden keine Elfen gegen ihren Willen gequält.
Die stehen auf den kranken Mist, ehrlich!

‹‹ First ‹ Prev Comments(11) Next › Last ››

Und hier ein kleines Gimmick für diejenigen, die im YPS-Fieber sind:

MPSAGKKRRIIAFDKNGKRQKEEPTESDEDRVPHKKAKSDTLEQRRAQSLKHTKSSFEED
LGRLTQEVNELKTGGQEQDQDWCRPHLPKSWNPQEESLIFQQIECDEGTFDRKTTIQLFG
VTEAGHSVLLHVTDFHHYLYVAAPIGFTQQHIPGFRGFLEAKLQNGLDPAIACVHLLLRE
NLYGFNGNQQSPLIEHGDANYQKMWPAGDGGIMTYDAIQYVMRFMVDTMIPGMSWVEVPA
GEYRLVDTREKLSNCQIEAKVHFKNLISHPSEGEYQKMAPLRILSFDIECAGRKGIFPEP
HQDPVIQIANMITKYGESKPFIRNVFTLGTCASIVNTQVFSFNNEGKMLISWSQFLHEAD
PDVIIGYNIANFDFPYLLDRAKYLKLVEFPYWTRLRNVKSEAKDSNFSSKQMGNRDTKAT
NTNGRLQLDLLQLVQRDFQLRSYTLNSVSAHFLGEQKEDVHHSMITELQNGTADSRRRLA
VYCLKDAYLPQRLMDKLMCLVNYTEMARVTGVPFNYLLSRGQQIKFISQLYRKAKEQKLV
VPNLPPQGGDDQYEGATVIEPERGYYDVPIATLDFASLYPSIMQAHNLCYTTLVKKETCD
RLGLQKDIDYEITPNGDRFVKAHRRKGMVPLILEALLGARKKAKADLKKATDPFEKAVLN
GRQLALKISANSVYGITGATVGKLPCLPIASSVTGYGRQMIMRTKEEVEKRYTIANGYTH
DAKVIYGDTDSVMVKFGPKDLPAAMELGKEAAEFVSQKFVTPIKLEFEKVYFPYLLINKK
RYAGLYWTNTEKHDKMDSKGIETVRRDNCRLLLIDQDVEGAQTYVKDLISDLLQNRIDMS
QLVITKALSKNDYTAKQAHVELAERMRKRDAGSAPTLGDRVAYVIVKGAGGAKNYEKSED
PIFVLENSVPIDTKYYLENQLSKPLSRIFEPIIGDRKAQQLLTGDHTRTISVSAPTVGGL
MKFAKKTETCMGCKIPLTKKEEAGGAVCSDCKPRFGELYQKTVTRVSELEVKFSRLWTQC
QRCQGSIHCEVICSSRDCPIFYMRMKAKKDVVDAGKDLRRFDVDISW

Dies ist eine Protein-Sequenz des Tuber melansporum, des Schwarzen Perigord Trüffel.
Wer will, kann dies für eine eigene Nachzucht verwenden (allerdings muss man die restlichen Sequenzen noch selber hinzufügen).

Viel Spaß und guten Appetit.

11 Gedanken zu „Anhänglich

    • Und ich erst…
      … moment… ich schreib ja die Story… ähhh… 😉

      Achja, Mario – ich glaub, ich hab mich bei deinem Webcomic noch garnicht in den Kommentaren verewigt. Aber dank Michaels schöner Linkliste bin ich auch gerne auf deiner Seite und schmökere vor mich hin. Mach bitte weiter so!

  1. Sehr schöner Comic mit sehr schöner Story.

    Ich muss allerdings bemängeln, dass die DNA-Sequenz des Trüffels nicht das selbe ist wie die Proteinsequenz 😉
    Für den Laien: DNA-Sequenzen können mit maximal 4 Buchstaben (bzw Basen) aufwarten. Proteinsequenzen kommen fast auf das ganze Alphabet (21 Möglichkeiten).

    • Ups, das werd ich gleich mal korrigieren. Das kommt davon, wenn man solche Gimmick-Beiträge kurz vorm Schlafengehen schreibt 🙂

      Danke für die Korrektur und das Lob für den Comic. 😀

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.

This site uses Akismet to reduce spam. Learn how your comment data is processed.